Copine-6 Antibody


Western Blot: Copine-6 Antibody [NBP1-69195] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Product Discontinued
View other related Copine-6 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Copine-6 Antibody Summary

Synthetic peptides corresponding to CPNE6 (copine VI (neuronal)) The peptide sequence was selected from the middle region of CPNE6. Peptide sequence LPQIQLYGPTNVAPIINRVAEPAQREQSTGQATKYSVLLVLTDGVVSDMA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CPNE6 and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Copine-6 Antibody

  • copine VI (neuronal)
  • Copine VI
  • copine-6
  • neuronal copine
  • neuronal-copine


This gene encodes a brain-specific member of the copine family, which is composed of calcium-dependent membrane-binding proteins. The gene product contains two N-terminal C2 domains, and one von Willebrand factor A domain. It may have a role in synaptic plasticity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Copine-6 Antibody (NBP1-69195) (0)

There are no publications for Copine-6 Antibody (NBP1-69195).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Copine-6 Antibody (NBP1-69195) (0)

There are no reviews for Copine-6 Antibody (NBP1-69195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Copine-6 Antibody (NBP1-69195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Copine-6 Products

Bioinformatics Tool for Copine-6 Antibody (NBP1-69195)

Discover related pathways, diseases and genes to Copine-6 Antibody (NBP1-69195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Copine-6 Antibody (NBP1-69195)

Find related products by research area.

Blogs on Copine-6

There are no specific blogs for Copine-6, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Copine-6 Antibody and receive a gift card or discount.


Gene Symbol CPNE6