Connexin 62/GJA10 Antibody - BSA Free

Western Blot: Connexin 62/GJA10 Antibody [NBP3-10556] - Western blot analysis of Connexin 62/GJA10 in Mouse Heart as a positive control. Antibody dilution at 0.2-1 ug/ml

Product Discontinued

Connexin 62/GJA10 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034419). Peptide sequence MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVWDDEQS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJA10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Connexin 62/GJA10 Antibody - BSA Free

• Connexin 62
• connexin-62
• Cx62
• CX62gap junction alpha-10 protein
• gap junction protein, alpha 10, 62kDa
• GJA10
• RP11-63K6.6

Background

Connexins, such as GJA10, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJA10