COL6A6 Antibody

Images

 
Immunohistochemistry-Paraffin: COL6A6 Antibody [NBP2-14546] - Staining of human lung shows moderate to strong membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: COL6A6 Antibody [NBP2-14546] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: COL6A6 Antibody [NBP2-14546] - Staining of human breast shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: COL6A6 Antibody [NBP2-14546] - Staining of human skin shows moderate positivity in extracellular matrix.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COL6A6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRN
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL6A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COL6A6 Protein (NBP2-14546PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COL6A6 Antibody

  • COL6A6 collagen, type VI, alpha 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00256076-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-6588
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PCR, WB
NBP2-97126
Species: Hu
Applications: ELISA, WB
H00001292-M01
Species: Hu, Po
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-14546
Species: Hu, Rt
Applications: IHC

Publications for COL6A6 Antibody (NBP2-14546) (0)

There are no publications for COL6A6 Antibody (NBP2-14546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL6A6 Antibody (NBP2-14546) (0)

There are no reviews for COL6A6 Antibody (NBP2-14546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COL6A6 Antibody (NBP2-14546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COL6A6 Products

Array NBP2-14546

Diseases for COL6A6 Antibody (NBP2-14546)

Discover more about diseases related to COL6A6 Antibody (NBP2-14546).
 

Pathways for COL6A6 Antibody (NBP2-14546)

View related products by pathway.

Blogs on COL6A6

There are no specific blogs for COL6A6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL6A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL6A6