COL22A1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: COL22A1 Antibody [NBP1-91056] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: COL22A1 Antibody [NBP1-91056] - Staining of human placenta shows no expression in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: COL22A1 Antibody [NBP1-91056] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: COL22A1 Antibody [NBP1-91056] - Staining of human small intestine shows moderate postivity in extracellular matrix of glandular cells.

Immunohistochemistry-Paraffin: COL22A1 Antibody [NBP1-91056] - Staining of human liver shows no expression in hepatocytes as expected.

Staining of human testis shows weak cytoplasmic positivity in a subset of cells in seminiferous ducts.

Staining of human cell line U-2 OS shows localization to vesicles.

Staining of human placenta shows no positivity in trophoblastic cells as expected.

Staining of human pituitary gland shows moderate cytoplasmic positivity in a subset of glandular cells.

Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COL22A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit COL22A1 Antibody - BSA Free (NBP1-91056) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-COL22A1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKEELEEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGGTKEITGFDLMDLFSVKEILGKRENGAQSSYVRMG
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL22A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in reported in scientific literature (PMID: 30678304).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  COL22A1 Protein (NBP1-91056PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for COL22A1 Antibody - BSA Free

• collagen, type XXII, alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COL22A1 Antibody (NBP1-91056)(1)

Publication using NBP1-91056

• Watanabe T, Frost DB, Mlakar L et al. A Human Skin Model Recapitulates Systemic Sclerosis Dermal Fibrosis and Identifies COL22A1 as a TGFbeta Early Response Gene that Mediates Fibroblast to Myofibroblast Transition Genes (Basel) 2019-01-22 [PMID: 30678304] (WB, Human)

Bioinformatics

• Gene Symbol: COL22A1