CNIH4 Antibody (4E10-1G4)

Images

 
Western Blot: CNIH4 Antibody (4E10-1G4) [H00029097-M01] - HSPC163 monoclonal antibody (M01), clone 4E10-1G4 Analysis of HSPC163 expression in A-431.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4E10-1G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CNIH4 Antibody (4E10-1G4) Summary

Immunogen
HSPC163 (AAH00573, 1 a.a. ~ 139 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND
Specificity
CNIH4 - HSPC163 protein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CNIH4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate for western blot. It has also been used for ELISA.
Control
CNIH4 Knockout 293T Cell Lysate

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CNIH4 Antibody (4E10-1G4)

  • cornichon homolog 4 (Drosophila)
  • HSPC163
  • protein cornichon homolog 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-01225
Species: Hu
Applications: WB, IHC, IHC-P
H00005997-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA, KD
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00880
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-70653
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: WB, IHC
NBP2-13963
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81676
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CNIH4 Antibody (H00029097-M01) (0)

There are no publications for CNIH4 Antibody (H00029097-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNIH4 Antibody (H00029097-M01) (0)

There are no reviews for CNIH4 Antibody (H00029097-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNIH4 Antibody (H00029097-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CNIH4 Products

Bioinformatics Tool for CNIH4 Antibody (H00029097-M01)

Discover related pathways, diseases and genes to CNIH4 Antibody (H00029097-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNIH4 Antibody (H00029097-M01)

Discover more about diseases related to CNIH4 Antibody (H00029097-M01).

Research Areas for CNIH4 Antibody (H00029097-M01)

Find related products by research area.

Blogs on CNIH4

There are no specific blogs for CNIH4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNIH4 Antibody (4E10-1G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CNIH4
Entrez
Uniprot