CML2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CML2 Antibody - BSA Free [NBP3-03797] - Immunofluorescence analysis of A549 cells using CML2 Rabbit pAb (A13428). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CML2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CML2 Antibody - BSA Free (NBP3-03797) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human CML2 (NP_057431.2). WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAT8B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CML2 Antibody - BSA Free

• Camello-like protein 2
• CML2
• EC 2.3.1
• EC 2.3.1.-
• Hcml2
• MGC97061
• N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene)
• N-acetyltransferase 8B (gene/pseudogene)
• N-acetyltransferase Camello 2
• NAT8BP
• probable N-acetyltransferase 8B

Background

CML2 is encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAT8B