Home » CLIC1 » CLIC1 Antibodies » CLIC1 Antibody (2D4)

CLIC1 Antibody (2D4)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CLIC1 Antibody (2D4) [H00001192-M01] - CLIC1 monoclonal antibody (M01), clone 2D4 Analysis of CLIC1 expression in HL-60.
Western Blot: CLIC1 Antibody (2D4) [H00001192-M01] - CLIC1 monoclonal antibody (M01), clone 2D4 Analysis of CLIC1 expression in HL-60.
Immunocytochemistry/ Immunofluorescence: CLIC1 Antibody (2D4) [H00001192-M01] - Analysis of monoclonal antibody to CLIC1 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CLIC1 Antibody (2D4) [H00001192-M01] - Analysis of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.
ELISA: CLIC1 Antibody (2D4) [H00001192-M01] - Detection limit for recombinant GST tagged CLIC1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CLIC1 Antibody (2D4) Summary

Immunogen
CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Specificity
CLIC1 - chloride intracellular channel 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLIC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00001192-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLIC1 Antibody (2D4)

  • Chloride channel ABP
  • chloride intracellular channel 1
  • chloride intracellular channel protein 1
  • G6
  • hRNCC
  • NCC27p64CLCP
  • Nuclear chloride ion channel 27
  • nuclear chloride ion channel protein
  • Regulatory nuclear chloride ion channel protein
  • RNCC protein

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BAT3/BAG6 Antibody
AF6438
BAT3/BAG6 was detected in immersion fixed immature human dendritic cells using Sheep Anti-Human/Mouse/Rat BAT3/BAG6 Affinity-purified Polyclonal Antibody (Catalog # AF6438) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counter­stained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of A431 human epithelial carcinoma cell line, HeLa human cervical epithelial carcinoma cell line, BaF3 mouse pro-B cell line, CH‑1 mouse B cell lymphoma cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat BAT3/BAG6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6438) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BAT3/BAG6 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: ICC, WB
MSH5 Antibody
NBP1-20946
Immunohistochemistry-Paraffin: MSH5 Antibody [NBP1-20946] - Staining of Human Thymus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: MSH5 Antibody [NBP1-20946] - Staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
BUD31 Antibody
NBP1-84010
Western Blot: BUD31 Antibody [NBP1-84010] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: BUD31 Antibody [NBP1-84010] - Staining of human nasopharynx shows strong cytoplasmic and nuclear positivity in respiratory epithelial cells.
Immunocytochemistry/Immunofluorescence: BUD31 Antibody [NBP1-84010] - Staining of human cell line U-2 OS shows localization to nucleus & microtubules. Antibody staining is shown in green.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ZBTB12 Antibody
H00221527-B01P
Immunocytochemistry/Immunofluorescence: ZBTB12 Antibody [H00221527-B01P] - Analysis of purified antibody to ZBTB12 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: ZBTB12 Antibody [H00221527-B01P] - Analysis of ZBTB12 expression in transfected 293T cell line by ZBTB12 polyclonal antibody. Lane 1: ZBTB12 transfected lysate(50.49 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, WB
CLIC4 Antibody
NBP1-85574
Immunohistochemistry-Paraffin: CLIC4 Antibody [NBP1-85574] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: CLIC4 Antibody [NBP1-85574] - Staining in human kidney and skeletal muscle tissues using anti-CLIC4 antibody. Corresponding CLIC4 RNA-seq data are presented for the same tissues.
Western Blot: CLIC4 Antibody [NBP1-85574] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-CLIC4 antibody. Corresponding CLIC4 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
BAT5 Antibody
NBP2-15548
Western Blot: BAT5 Antibody [NBP2-15548] - Sample (30 ug of whole cell lysate) A:U87-MG 7. 5% SDS PAGE gel, diluted at 1:2000.
Immunohistochemistry-Paraffin: BAT5 Antibody [NBP2-15548] - Human colon carcinoma, using BAT5 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu
Applications: IHC, IHC-P, WB
GPANK1/BAT4
Antibody
NBP1-90165
Immunohistochemistry-Paraffin: GPANK1/BAT4 Antibody [NBP1-90165] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/Immunofluorescence: GPANK1/BAT4 Antibody [NBP1-90165] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Western Blot: GPANK1/BAT4 Antibody [NBP1-90165] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Common gamma
Chain/IL-2 R gamma An ...
AF284
Recombinant Human IL‑2 (Catalog # 202-IL) stimulates proliferation in the MO7e human megakaryocytic leukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human IL‑2 (30 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Common  gamma  Chain/IL‑2 R gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF284). The ND50 is typically 20-60 µg/mL.
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
SLC7A4 Antibody
NBP1-86613
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLC7A4 Antibody [NBP1-86613] - Staining in human testis and endometrium tissues using anti-SLC7A4 antibody. Corresponding SLC7A4 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
CLIC2 Antibody
NBP2-32516
Western Blot: CLIC2 Antibody [NBP2-32516] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: CLIC2 Antibody [NBP2-32516] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu
Applications: IHC, IHC-P, WB
Goat anti-Chicken
IgM Heavy Chain Secon ...
NB7276
Goat anti-Chicken IgM Heavy Chain Secondary Antibody
(37 Publications)
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Fucosyltransferase
2/FUT2 Antibody
NBP2-26116
Immunohistochemistry-Paraffin: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Placenta. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Liver lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
SQLE Antibody
NBP2-32005
Western Blot: SQLE Antibody [NBP2-32005] - Analysis in human cell line MCF-7 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
CD55/DAF was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using 15 µg/mL Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CD55/DAF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line (left panel, positive staining) and MOLT-4 human acute lymphoblastic leukemia cell line (right panel, negative staining) using Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) at 0.5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: ICC, IHC

Publications for CLIC1 Antibody (H00001192-M01)(2)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CLIC1 Antibody (H00001192-M01) (0)

There are no reviews for CLIC1 Antibody (H00001192-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLIC1 Antibody (H00001192-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLIC1 Products

Bioinformatics Tool for CLIC1 Antibody (H00001192-M01)

Discover related pathways, diseases and genes to CLIC1 Antibody (H00001192-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC1 Antibody (H00001192-M01)

Discover more about diseases related to CLIC1 Antibody (H00001192-M01).
 

Pathways for CLIC1 Antibody (H00001192-M01)

View related products by pathway.

PTMs for CLIC1 Antibody (H00001192-M01)

Learn more about PTMs related to CLIC1 Antibody (H00001192-M01).
 

Research Areas for CLIC1 Antibody (H00001192-M01)

Find related products by research area.

Blogs on CLIC1

There are no specific blogs for CLIC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIC1 Antibody (2D4) and receive a gift card or discount.


Bioinformatics

Gene Symbol CLIC1
Entrez
Uniprot