CLIC1 Antibody (2D4)

Images

 
Western Blot: CLIC1 Antibody (2D4) [H00001192-M01] - CLIC1 monoclonal antibody (M01), clone 2D4 Analysis of CLIC1 expression in HL-60.
Immunocytochemistry/ Immunofluorescence: CLIC1 Antibody (2D4) [H00001192-M01] - Analysis of monoclonal antibody to CLIC1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CLIC1 Antibody (2D4) [H00001192-M01] - Analysis of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.
ELISA: CLIC1 Antibody (2D4) [H00001192-M01] - Detection limit for recombinant GST tagged CLIC1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CLIC1 Antibody (2D4) Summary

Immunogen
CLIC1 (AAH64527.1, 1 a.a. - 241 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Specificity
CLIC1 - chloride intracellular channel 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLIC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00001192-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLIC1 Antibody (2D4)

  • Chloride channel ABP
  • chloride intracellular channel 1
  • chloride intracellular channel protein 1
  • G6
  • hRNCC
  • NCC27p64CLCP
  • Nuclear chloride ion channel 27
  • nuclear chloride ion channel protein
  • Regulatory nuclear chloride ion channel protein
  • RNCC protein

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15548
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32516
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC

Publications for CLIC1 Antibody (H00001192-M01)(2)

Reviews for CLIC1 Antibody (H00001192-M01) (0)

There are no reviews for CLIC1 Antibody (H00001192-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLIC1 Antibody (H00001192-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLIC1 Products

Bioinformatics Tool for CLIC1 Antibody (H00001192-M01)

Discover related pathways, diseases and genes to CLIC1 Antibody (H00001192-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC1 Antibody (H00001192-M01)

Discover more about diseases related to CLIC1 Antibody (H00001192-M01).
 

Pathways for CLIC1 Antibody (H00001192-M01)

View related products by pathway.

PTMs for CLIC1 Antibody (H00001192-M01)

Learn more about PTMs related to CLIC1 Antibody (H00001192-M01).
 

Research Areas for CLIC1 Antibody (H00001192-M01)

Find related products by research area.

Blogs on CLIC1

There are no specific blogs for CLIC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIC1 Antibody (2D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIC1
Entrez
Uniprot