CKI gamma 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CKI gamma 3 Antibody [NBP1-91045] - Staining of human tonsil shows nuclear and cytoplasmic positivity in both germinal center and non-germinal center cells.

Immunohistochemistry-Paraffin: CKI gamma 3 Antibody [NBP1-91045] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKI gamma 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKV
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSNK1G3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CKI gamma 3 Protein (NBP1-91045PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CKI gamma 3 Antibody - BSA Free

• casein kinase 1, gamma 3
• casein kinase I isoform gamma-3
• CKI gamma 3
• CKI-gamma 3
• CSNK1G3
• EC 2.7.11
• EC 2.7.11.1

Background

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseinsas substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSNK1G3