Recombinant Human CHMP1B Protein

Images

 
SDS-Page: Recombinant Human CHMP1B Protein [H00057132-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CHMP1B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-199 of Human CHMP1B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CHMP1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
48.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHMP1B Protein

  • C18orf2C10orf2
  • charged multivesicular body protein 1b
  • CHMP1.5C18-ORF2
  • CHMP1b
  • chromatin modifying protein 1B
  • Chromatin-modifying protein 1b
  • hVps46-2
  • vacuolar protein sorting 46-2
  • Vacuolar protein sorting-associated protein 46-2
  • Vps46-2
  • Vps46B

Background

CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52300
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59594
Species: Rt
Applications: WB, ICC/IF, IHC
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54618
Species: Hu
Applications: WB, IHC
NBP2-92801
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92505
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67199
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-52300
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52097
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP2-94064
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33015
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91780
Species: Hu
Applications: IHC, IHC-P
NBP1-89391
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14436
Species: Hu
Applications: IHC, IHC-P
H00057132-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CHMP1B Recombinant Protein (H00057132-P01) (0)

There are no publications for CHMP1B Recombinant Protein (H00057132-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHMP1B Recombinant Protein (H00057132-P01) (0)

There are no reviews for CHMP1B Recombinant Protein (H00057132-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHMP1B Recombinant Protein (H00057132-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CHMP1B Products

Bioinformatics Tool for CHMP1B Recombinant Protein (H00057132-P01)

Discover related pathways, diseases and genes to CHMP1B Recombinant Protein (H00057132-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHMP1B Recombinant Protein (H00057132-P01)

Discover more about diseases related to CHMP1B Recombinant Protein (H00057132-P01).
 

Pathways for CHMP1B Recombinant Protein (H00057132-P01)

View related products by pathway.

PTMs for CHMP1B Recombinant Protein (H00057132-P01)

Learn more about PTMs related to CHMP1B Recombinant Protein (H00057132-P01).

Blogs on CHMP1B

There are no specific blogs for CHMP1B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHMP1B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP1B