CHMP1B Recombinant Protein Antigen

Images

 
There are currently no images for CHMP1B Protein (NBP2-38007PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CHMP1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHMP1B.

Source: E.coli

Amino Acid Sequence: TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHMP1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38007.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CHMP1B Recombinant Protein Antigen

  • C18orf2C10orf2
  • charged multivesicular body protein 1b
  • CHMP1.5C18-ORF2
  • CHMP1b
  • chromatin modifying protein 1B
  • Chromatin-modifying protein 1b
  • hVps46-2
  • vacuolar protein sorting 46-2
  • Vacuolar protein sorting-associated protein 46-2
  • Vps46-2
  • Vps46B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52300
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59594
Species: Rt
Applications: WB, ICC/IF, IHC
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54618
Species: Hu
Applications: WB, IHC
NBP2-92801
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92505
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67199
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-52300
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52097
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP2-94064
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33015
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91780
Species: Hu
Applications: IHC, IHC-P
NBP1-89391
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14436
Species: Hu
Applications: IHC, IHC-P
NBP2-38007PEP
Species: Hu
Applications: AC

Publications for CHMP1B Protein (NBP2-38007PEP) (0)

There are no publications for CHMP1B Protein (NBP2-38007PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHMP1B Protein (NBP2-38007PEP) (0)

There are no reviews for CHMP1B Protein (NBP2-38007PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CHMP1B Protein (NBP2-38007PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CHMP1B Products

Bioinformatics Tool for CHMP1B Protein (NBP2-38007PEP)

Discover related pathways, diseases and genes to CHMP1B Protein (NBP2-38007PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHMP1B Protein (NBP2-38007PEP)

Discover more about diseases related to CHMP1B Protein (NBP2-38007PEP).
 

Pathways for CHMP1B Protein (NBP2-38007PEP)

View related products by pathway.

PTMs for CHMP1B Protein (NBP2-38007PEP)

Learn more about PTMs related to CHMP1B Protein (NBP2-38007PEP).

Blogs on CHMP1B

There are no specific blogs for CHMP1B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CHMP1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP1B