CEP76 Antibody

Images

 
Immunohistochemistry: CEP76 Antibody [NBP1-88472] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP76 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP76
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CEP76 Protein (NBP1-88472PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP76 Antibody

  • C18orf9
  • centrosomal protein 76kDa
  • centrosomal protein of 76 kDa
  • Cep76
  • chromosome 18 open reading frame 9
  • FLJ12542
  • HsT1705

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39059
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57533
Species: Hu
Applications: ICC/IF
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-88451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004867-D01P
Species: Hu, Mu
Applications: WB
NBP1-94074
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-80773
Species: Hu
Applications: IHC, IHC-P
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79815
Species: Hu
Applications: WB
NBP2-15738
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87957
Species: Hu
Applications: IHC, IHC-P
NBP1-81953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88472
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CEP76 Antibody (NBP1-88472) (0)

There are no publications for CEP76 Antibody (NBP1-88472).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP76 Antibody (NBP1-88472) (0)

There are no reviews for CEP76 Antibody (NBP1-88472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CEP76 Antibody (NBP1-88472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEP76 Products

Bioinformatics Tool for CEP76 Antibody (NBP1-88472)

Discover related pathways, diseases and genes to CEP76 Antibody (NBP1-88472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP76 Antibody (NBP1-88472)

Discover more about diseases related to CEP76 Antibody (NBP1-88472).
 

Pathways for CEP76 Antibody (NBP1-88472)

View related products by pathway.

PTMs for CEP76 Antibody (NBP1-88472)

Learn more about PTMs related to CEP76 Antibody (NBP1-88472).

Blogs on CEP76

There are no specific blogs for CEP76, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP76 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP76