CD320/TCblR/8D6A Antibody (4F2) Summary
| Immunogen |
CD320 (AAH00668, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CD320 |
| Purity |
Unpurified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for ELISA, Western Blot |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
Ascites |
| Preservative |
No Preservative |
| Purity |
Unpurified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CD320/TCblR/8D6A Antibody (4F2)
Background
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-reported, Flow, IHC, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Publications for CD320/TCblR/8D6A Antibody (H00051293-M04A) (0)
There are no publications for CD320/TCblR/8D6A Antibody (H00051293-M04A).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD320/TCblR/8D6A Antibody (H00051293-M04A) (0)
There are no reviews for CD320/TCblR/8D6A Antibody (H00051293-M04A).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD320/TCblR/8D6A Antibody (H00051293-M04A). (Showing 1 - 1 of 1 FAQ).
-
Is it possible to know what is the amino acid sequence that represent the epitope of this antibody (Catalog Number H00051293-M04A). It's mention that immunogen is 1-282 aa ( full sequence protein). but its crucial to us to know to which aa sequence( or region) of the antigen your monoclonal antibody is directed.
- The CD320 antibody with catalogue number H00051293-M04A is produced by a Taiwanese company called Abnova, for whom we distribute. Unfortunately they do not epitope map their antibodies and so I am unable to give you any further information regarding the binding of this antibody to its target. We do offer one other CD320 antibody. This is a rabbit polyclonal and has catalogue number NBP1-89348. The immunogen is a peptide with the following sequence: AQERLRPLGLLVAMKESLLLSEQKTSLP which maps to the C-terminus (aa255-282) of the human protein.
Secondary Antibodies
| |
Isotype Controls
|
Additional CD320/TCblR/8D6A Products
Research Areas for CD320/TCblR/8D6A Antibody (H00051293-M04A)
Find related products by research area.
|
Blogs on CD320/TCblR/8D6A