CD2BP2 Recombinant Protein Antigen

Images

 
There are currently no images for CD2BP2 Recombinant Protein Antigen (NBP2-49328PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD2BP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD2BP2.

Source: E. coli

Amino Acid Sequence: MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD2BP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49328.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD2BP2 Recombinant Protein Antigen

  • CD2 (cytoplasmic tail) binding protein 2
  • CD2 antigen (cytoplasmic tail) binding protein 2
  • CD2 antigen (cytoplasmic tail)-binding protein 2
  • CD2 antigen cytoplasmic tail-binding protein 2
  • CD2 binding protein 2
  • CD2 cytoplasmic domain binding protein 2
  • CD2 cytoplasmic domain-binding protein 2
  • CD2 tail-binding protein 2
  • FWP010
  • KIAA1178
  • LIN1
  • Snu40
  • U5 snRNP 52K protein
  • U5-52K

Background

CD2BP2 is an intracellular protein which binds to a site containing two PPPGHR segments within the cytoplasmic region of CD2. Mutagenesis and NMR analysis demonstrated that the CD2 binding region of CD2BP2 includes a 17 amino acid motif also found in several yeast and Caenorhabditis elegans proteins of unknown function. In Jurkat T cells, over expression of the isolated CD2BP2 domain binding to CD2 enhances the production of interleukin 2 on crosslinking of CD2 but not the T cell receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-41181
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, Simple Western, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32174
Species: Dr, Hu
Applications: ICC/IF, WB
NBP2-20541
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010908-M08
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-21601
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NB100-1178
Species: Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, PEP-ELISA, WB
AF4885
Species: Mu
Applications: IP, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB

Publications for CD2BP2 Recombinant Protein Antigen (NBP2-49328PEP) (0)

There are no publications for CD2BP2 Recombinant Protein Antigen (NBP2-49328PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD2BP2 Recombinant Protein Antigen (NBP2-49328PEP) (0)

There are no reviews for CD2BP2 Recombinant Protein Antigen (NBP2-49328PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD2BP2 Recombinant Protein Antigen (NBP2-49328PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD2BP2 Products

Array NBP2-49328PEP

Research Areas for CD2BP2 Recombinant Protein Antigen (NBP2-49328PEP)

Find related products by research area.

Blogs on CD2BP2

There are no specific blogs for CD2BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD2BP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD2BP2