CCDC88B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CCDC88B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCDC88B.
  
  

  Source: E. coli

  Amino Acid Sequence: GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CCDC88B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88350.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CCDC88B Recombinant Protein Antigen

• 78 kDa glucose-regulated protein GRP78-interacting protein induced by ER stress
• brain leucine zipper domain-containing protein
• brain leucine zipper protein
• CCDC88
• coiled-coil domain containing 88B
• coiled-coil domain-containing protein 88B
• gipie
• HKRP3
• hook-related protein 3

Background

CCDC88B, also known as Coiled-coil domain-containing protein 88B, has 6 isoforms, a 1476 amino acid isoform that is 165 kDa, a 1034 amino acid isoform that is 114 kDa, a 621 amino acid isoform that is 67 kDa, a 1358 amino acid isoform that is 151 kDa, 696 amino acid isoform that is 79 kDa, and a 139 amino acid isoform that is 15 kDa; and may be involved in linking organelles to microtubules. This protein has been associated with LPS-induced acute lung injury, cerulein induced chronic pancreatitis, Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema, and Smith-Lemli-Opitz syndrome. CCDC88B interacts with PLEKHA5, PBX2, MAP3K7 and GRP78 in signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CCDC88B