CCDC44 Antibody


Western Blot: CCDC44 Antibody [NBP1-88161] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88161] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CCDC44 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDE
Specificity of human CCDC44 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC44 Protein (NBP1-88161PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCDC44 Antibody

  • CCDC44translational activator of cytochrome c oxidase 1
  • clone HQ0477 PRO0477p
  • coiled-coil domain containing 44
  • Coiled-coil domain-containing protein 44
  • translational activator of mitochondrially encoded cytochrome c oxidase I
  • Translational activator of mitochondrially-encoded cytochrome c oxidase I


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CCDC44 Antibody (NBP1-88161) (0)

There are no publications for CCDC44 Antibody (NBP1-88161).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC44 Antibody (NBP1-88161) (0)

There are no reviews for CCDC44 Antibody (NBP1-88161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC44 Antibody (NBP1-88161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCDC44 Products

Bioinformatics Tool for CCDC44 Antibody (NBP1-88161)

Discover related pathways, diseases and genes to CCDC44 Antibody (NBP1-88161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC44 Antibody (NBP1-88161)

Discover more about diseases related to CCDC44 Antibody (NBP1-88161).

Pathways for CCDC44 Antibody (NBP1-88161)

View related products by pathway.

Blogs on CCDC44

There are no specific blogs for CCDC44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC44 Antibody and receive a gift card or discount.


Gene Symbol TACO1