CCDC44 Antibody

Images

 
Western Blot: CCDC44 Antibody [NBP1-88161] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CCDC44 Antibody [NBP1-88161] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC44 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TACO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC44 Protein (NBP1-88161PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC44 Antibody

  • CCDC44translational activator of cytochrome c oxidase 1
  • clone HQ0477 PRO0477p
  • coiled-coil domain containing 44
  • Coiled-coil domain-containing protein 44
  • translational activator of mitochondrially encoded cytochrome c oxidase I
  • Translational activator of mitochondrially-encoded cytochrome c oxidase I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88161
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CCDC44 Antibody (NBP1-88161) (0)

There are no publications for CCDC44 Antibody (NBP1-88161).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC44 Antibody (NBP1-88161) (0)

There are no reviews for CCDC44 Antibody (NBP1-88161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC44 Antibody (NBP1-88161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC44 Products

Bioinformatics Tool for CCDC44 Antibody (NBP1-88161)

Discover related pathways, diseases and genes to CCDC44 Antibody (NBP1-88161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC44 Antibody (NBP1-88161)

Discover more about diseases related to CCDC44 Antibody (NBP1-88161).
 

Pathways for CCDC44 Antibody (NBP1-88161)

View related products by pathway.

Blogs on CCDC44

There are no specific blogs for CCDC44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TACO1