Cbx2 Antibody (1E9) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Cbx2 Antibody (1E9) - Azide and BSA Free (H00084733-M09) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CBX2 (NP_116036, 66 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSP |
| Specificity |
This product is specific for Human CBX2 monoclonal antibody (M09), clone 1E9 [Gene ID: 84733]. |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CBX2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Mouse monoclonal antibody raised against a partial recombinant CBX2. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Cbx2 Antibody (1E9) - Azide and BSA Free
Background
Polycomb' genes in Drosophila maintain the repressed state of homeotic and other developmentally regulatedgenes (Wedeen et al., 1986 (PubMed 3081265); Kuziora and McGinnis, 1988 (PubMed 2903050)) by mediating changes inhigher-order chromatin structure (Paro and Hogness, 1991 (PubMed 1898775)). M33, a mouse homolog of polycomb, wasisolated by means of the structural similarity of its chromodomain (Pearce et al., 1992 (PubMed 1352241)). The fifthexon of M33 contains a region of homology shared by Drosophila and Xenopus. In Drosophila, its deletion results in theloss of polycomb function.(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Publications for Cbx2 Antibody (H00084733-M09) (0)
There are no publications for Cbx2 Antibody (H00084733-M09).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cbx2 Antibody (H00084733-M09) (0)
There are no reviews for Cbx2 Antibody (H00084733-M09).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cbx2 Antibody (H00084733-M09) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cbx2 Products
Research Areas for Cbx2 Antibody (H00084733-M09)
Find related products by research area.
|
Blogs on Cbx2