Cav1.3 Recombinant Protein Antigen

Images

 
There are currently no images for Cav1.3 Protein (NBP1-86684PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cav1.3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1D.

Source: E. coli

Amino Acid Sequence: EDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA1D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86684.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cav1.3 Recombinant Protein Antigen

  • CACH3
  • CACN4
  • CACN4calcium channel, neuroendocrine/brain-type, alpha 1 subunit
  • CACNA1D
  • CACNL1A2
  • CACNL1A2voltage-dependent L-type calcium channel subunit alpha-1D
  • Calcium channel, L type, alpha-1 polypeptide, isoform 2
  • calcium channel, voltage-dependent, L type, alpha 1D subunit
  • Cav1.3
  • CCHL1A2
  • CCHL1A2voltage-gated calcium channel alpha 1 subunit
  • L type, alpha-1 polypeptide
  • voltage-gated calcium channel alpha subunit Cav1.3
  • Voltage-gated calcium channel subunit alpha Cav1.3

Background

Function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA).; Subcellular location: Membrane; Multi-pass membrane protein.; Tissue specificity: Expressed in pancreatic islets and in brain, where it has been seen in hippocampus, basal ganglia, habenula and thalamus. No expression in skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-47733
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-92004
Species: Hu, Mu, Rt
Applications: WB
H00001806-M01
Species: Hu
Applications: DB, ELISA, ICC/IF, WB
NBP1-85224
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-59322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-46574
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00025861-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
AF3975
Species: Hu
Applications: ICC, WB
NBP2-68869
Species: Hu
Applications: IHC,  IHC-P

Publications for Cav1.3 Protein (NBP1-86684PEP) (0)

There are no publications for Cav1.3 Protein (NBP1-86684PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cav1.3 Protein (NBP1-86684PEP) (0)

There are no reviews for Cav1.3 Protein (NBP1-86684PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cav1.3 Protein (NBP1-86684PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cav1.3 Products

Research Areas for Cav1.3 Protein (NBP1-86684PEP)

Find related products by research area.

Blogs on Cav1.3

There are no specific blogs for Cav1.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cav1.3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1D