Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free

Sandwich ELISA: Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) [H00023563-M05] - Detection limit for recombinant GST tagged CHST5 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free (H00023563-M05) is a monoclonal antibody validated for use in WB and ELISA. Anti-Carbohydrate Sulfotransferase 5/CHST5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CHST5 (NP_036258.1, 310 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD
• Specificity: CHST5 - carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 (2E6)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CHST5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbohydrate Sulfotransferase 5/CHST5 Antibody (2E6) - Azide and BSA Free

• carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
• Carbohydrate Sulfotransferase 5
• CHST5
• GlcNAc6ST3
• gn6st-3
• GST4-alpha
• hIGn6ST
• I-GlcNAc6ST

Background

The carbohydrates of glycoconjugates are highly diverse structures with variation in monosaccharide composition, glycosidic linkage positions, and branching of chains. Further diversity is added by the covalent addition of sulfate moieties to particular hydroxyl groups and amino groups of saccharides. The sulfate modifications of glycoproteins can be extensive in amount and frequently occur at high density. They can have a profound effect on the physiochemical properties of the glycoconjugates, at least in part through the addition of negative charge. Carbohydrate sulfation plays a critical role in many biologic processes. CHST5 belongs to the GST family of sulfotransferases, which also includes CHST1 (MIM 603797), CHST2 (MIM 603798), CHST3 (MIM 603799), and LSST. These enzymes are 6-O-sulfotransferases, which add sulfate to C6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) (Lee et al., 1999 [PubMed 10491328]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carbohydrate Sulfotransferase 5/CHST5 Antibody (H00023563-M05)(1)

Publication using H00023563-M05

• Bhatia S, Prabhu PN, Benefiel AC et al. Galacto-oligosaccharides may directly enhance intestinal barrier function through the modulation of goblet cells. Mol Nutr Food Res. 2014-11-25 [PMID: 25421108]

Bioinformatics

• Gene Symbol: CHST5
• Entrez:
  • 23563(Human)