Cadherin-26 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cadherin-26 Antibody [NBP1-80623] - Staining of human nasopharynx shows strong membranous and cytoplasmic positivity in respiratory epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cadherin-26 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cadherin-26 Antibody - BSA Free (NBP1-80623) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-Cadherin-26 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVELADAEVGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDH26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cadherin-26 Protein (NBP1-80623PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cadherin-26 Antibody - BSA Free

• cadherin 26
• cadherin-like 26
• cadherin-like protein 26
• Cadherin-like protein VR20
• VR20

Background

Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization and migration. Cadherin domains occur as repeats in the extracellular region and are thought to contribute to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. This gene encodes a cadherin domain-containing protein whose specific function has not yet been determined. Alternative splicing occurs at this locus and two transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cadherin-26 Antibody (NBP1-80623)(1)

Publication using NBP1-80623

• KlAmbt V, Buerger F, Wang C et al. Genetic Variants in ARHGEF6 Cause Congenital Anomalies of the Kidneys and Urinary Tract in Humans, Mice, and Frogs Journal of the American Society of Nephrology : JASN 2022-11-22 [PMID: 36414417] (ELISA, WB, Mouse)

Bioinformatics

• Gene Symbol: CDH26
• Entrez:
  • 60437(Human)