C7orf57 Antibody

Images

 
Western Blot: C7orf57 Antibody [NBP2-82943] - Host: Rabbit. Target Name: C7orf57. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

C7orf57 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C7orf57. Peptide sequence: GQKNSSPTNFSKLISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
C7ORF57
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for C7orf57 Antibody

  • chromosome 7 open reading frame 57

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055277-M04
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-47481
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-89567
Species: Hu
Applications: ICC/IF, WB
NB100-2466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-33589
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-82943
Species: Hu
Applications: WB

Publications for C7orf57 Antibody (NBP2-82943) (0)

There are no publications for C7orf57 Antibody (NBP2-82943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C7orf57 Antibody (NBP2-82943) (0)

There are no reviews for C7orf57 Antibody (NBP2-82943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C7orf57 Antibody (NBP2-82943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C7orf57 Products

Diseases for C7orf57 Antibody (NBP2-82943)

Discover more about diseases related to C7orf57 Antibody (NBP2-82943).

Blogs on C7orf57

There are no specific blogs for C7orf57, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C7orf57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C7ORF57