C2CD5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KIAA0528 Antibody [NBP1-92050] - Immunofluorescent staining of human cell line RH-30 shows localization to cytosol & microtubule organizing center.

Immunohistochemistry-Paraffin: KIAA0528 Antibody [NBP1-92050] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

C2CD5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit C2CD5 Antibody - BSA Free (NBP1-92050) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSICEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFC
• Predicted Species: Mouse (95%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C2CD5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  C2CD5 Recombinant Protein Antigen (NBP1-92050PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for C2CD5 Antibody - BSA Free

• DKFZp779N2044
• hypothetical protein LOC9847
• KIAA0528

Background

KIAA0528 is a protein that was first identified in the in silico analysis of long cDNAs isolated in the Kazusa cDNA sequencing project. The function of KO528 has not been characterized. By similarity KO528 contains a C2 domain, a domain that is found in proteins that bind phospholipids. The C2 domain is also present in a family of proteins involved in synaptic vesicle trafficking; thus, the function of KO528 is predicted to be involved in intracellular transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C2CD5