C2CD2 Antibody


Western Blot: C2CD2 Antibody [NBP2-33941] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Orthogonal Strategies: Immunohistochemistry-Paraffin: C2CD2 Antibody [NBP2-33941] - Staining in human adrenal gland and skeletal muscle tissues using anti-C2CD2 antibody. Corresponding C2CD2 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: C2CD2 Antibody [NBP2-33941] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: C2CD2 Antibody [NBP2-33941] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

C2CD2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPPEEAESAQASLAPKPQEDELDSWDLEKEP
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C2CD2 Protein (NBP2-33941PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C2CD2 Antibody

  • C2 calcium-dependent domain containing 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC, WB

Publications for C2CD2 Antibody (NBP2-33941) (0)

There are no publications for C2CD2 Antibody (NBP2-33941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2CD2 Antibody (NBP2-33941) (0)

There are no reviews for C2CD2 Antibody (NBP2-33941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C2CD2 Antibody (NBP2-33941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional C2CD2 Products

Bioinformatics Tool for C2CD2 Antibody (NBP2-33941)

Discover related pathways, diseases and genes to C2CD2 Antibody (NBP2-33941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for C2CD2 Antibody (NBP2-33941)

Find related products by research area.

Blogs on C2CD2

There are no specific blogs for C2CD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C2CD2 Antibody and receive a gift card or discount.


Gene Symbol C2CD2