BTBD7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BTBD7 Antibody [NBP2-14364] - Staining of human cell line RT4 shows localization to focal adhesion sites.
Immunohistochemistry-Paraffin: BTBD7 Antibody [NBP2-14364] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTBD7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYY DVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIR TGEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTBD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTBD7 Protein (NBP2-14364PEP)
Publications
Read Publication using NBP2-14364.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTBD7 Antibody

  • BTB (POZ) domain containing 7
  • DKFZp686N0544
  • FLJ10648
  • FUP1BTB/POZ domain-containing protein 7
  • KIAA1525
  • MGC48310

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-14364
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for BTBD7 Antibody (NBP2-14364)(1)

Reviews for BTBD7 Antibody (NBP2-14364) (0)

There are no reviews for BTBD7 Antibody (NBP2-14364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BTBD7 Antibody (NBP2-14364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTBD7 Products

BTBD7 NBP2-14364

Bioinformatics Tool for BTBD7 Antibody (NBP2-14364)

Discover related pathways, diseases and genes to BTBD7 Antibody (NBP2-14364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD7 Antibody (NBP2-14364)

Discover more about diseases related to BTBD7 Antibody (NBP2-14364).
 

Pathways for BTBD7 Antibody (NBP2-14364)

View related products by pathway.

Blogs on BTBD7

There are no specific blogs for BTBD7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTBD7