BPIFA3 Antibody


Immunohistochemistry-Paraffin: BPIFA3 Antibody [NBP2-31864] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: BPIFA3 Antibody [NBP2-31864] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: BPIFA3 Antibody [NBP2-31864] - Staining in human testis and endometrium tissues using anti-BPIFA3 antibody. Corresponding BPIFA3 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

BPIFA3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGR
Specificity of human BPIFA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BPIFA3 Protein (NBP2-31864PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BPIFA3 Antibody

  • bA49G10.4
  • chromosome 20 open reading frame 71
  • MGC44525
  • short long palate, lung and nasal epithelium carcinoma associated 3
  • short palate, lung and nasal epithelium carcinoma-associated protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Species: Mu
Applications: WB, IHC
Species: Hu

Publications for BPIFA3 Antibody (NBP2-31864) (0)

There are no publications for BPIFA3 Antibody (NBP2-31864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPIFA3 Antibody (NBP2-31864) (0)

There are no reviews for BPIFA3 Antibody (NBP2-31864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BPIFA3 Antibody (NBP2-31864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BPIFA3 Products

Bioinformatics Tool for BPIFA3 Antibody (NBP2-31864)

Discover related pathways, diseases and genes to BPIFA3 Antibody (NBP2-31864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPIFA3 Antibody (NBP2-31864)

Discover more about diseases related to BPIFA3 Antibody (NBP2-31864).

Blogs on BPIFA3

There are no specific blogs for BPIFA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BPIFA3 Antibody and receive a gift card or discount.


Gene Symbol BPIFA3