Biotinidase/BTD Antibody

Images

 
Western Blot: Biotinidase/BTD Antibody [H00000686-D01P] - Analysis of BTD expression in transfected 293T cell line by BTD polyclonal antibody.Lane 1: BTD transfected lysate(61.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Biotinidase/BTD Antibody Summary

Immunogen
BTD (NP_000051.1, 1 a.a. - 543 a.a.) full-length human protein. MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD
Specificity
BTD - biotinidase,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTD
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Biotinidase/BTD Antibody

  • Biotinase
  • Biotinidase
  • BTD
  • EC 3.5.1
  • EC 3.5.1.12

Background

Biotinidase functions to recycle biotin in the body by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in regeneration of free biotin. Biotinidase has also been shown to have biotinyl-transferase activity. Defects in the biotinidase gene cause multiple carboxylase deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01859
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
7999-AH
Species: Hu
H00008875-B01P
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85179
Species: Hu
Applications: IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-87021
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32797
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-81330
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Biotinidase/BTD Antibody (H00000686-D01P) (0)

There are no publications for Biotinidase/BTD Antibody (H00000686-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biotinidase/BTD Antibody (H00000686-D01P) (0)

There are no reviews for Biotinidase/BTD Antibody (H00000686-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Biotinidase/BTD Antibody (H00000686-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Biotinidase/BTD Products

Bioinformatics Tool for Biotinidase/BTD Antibody (H00000686-D01P)

Discover related pathways, diseases and genes to Biotinidase/BTD Antibody (H00000686-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biotinidase/BTD Antibody (H00000686-D01P)

Discover more about diseases related to Biotinidase/BTD Antibody (H00000686-D01P).
 

Pathways for Biotinidase/BTD Antibody (H00000686-D01P)

View related products by pathway.

PTMs for Biotinidase/BTD Antibody (H00000686-D01P)

Learn more about PTMs related to Biotinidase/BTD Antibody (H00000686-D01P).

Blogs on Biotinidase/BTD

There are no specific blogs for Biotinidase/BTD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Biotinidase/BTD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTD
Entrez
Uniprot