beta B1 Crystallin Antibody (2B2)

Images

 
Sandwich ELISA: beta B1 Crystallin Antibody (2B2) [H00001414-M01] - Detection limit for recombinant GST tagged CRYBB1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

beta B1 Crystallin Antibody (2B2) Summary

Immunogen
CRYBB1 (AAH36790.1, 1 a.a. - 252 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK
Specificity
CRYBB1 - crystallin, beta B1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRYBB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for beta B1 Crystallin Antibody (2B2)

  • Beta-B1 crystallin
  • beta-crystallin B1
  • CATCN3
  • crystallin, beta B1
  • eye lens structural protein

Background

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta basic group member, undergoes extensive cleavage at its N-terminal extension during lens maturation. It is also a member of a gene cluster with beta-A4, beta-B2, and beta-B3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001415-M02
Species: Hu
Applications: WB, ELISA
NBP1-32741
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-49196
Species: Hu
Applications: IHC
NBP1-33010
Species: Mu
Applications: WB
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
31310002
Species: Hu
Applications: WB, ELISA
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32557
Species: Hu
Applications: WB
NBP1-84375
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58660
Species: Hu
Applications: IHC-P
MAB5695
Species: Hu, Mu
Applications: WB
NBP2-58661
Species: Hu
Applications: IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00001412-B02P
Species: Hu
Applications: WB
NBP2-07779
Species: Hu
NBP1-62297
Species: Hu
Applications: WB
NBP2-46573
Species: Hu
Applications: WB, IHC
H00001414-M01
Species: Hu
Applications: WB, ELISA

Publications for beta B1 Crystallin Antibody (H00001414-M01) (0)

There are no publications for beta B1 Crystallin Antibody (H00001414-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta B1 Crystallin Antibody (H00001414-M01) (0)

There are no reviews for beta B1 Crystallin Antibody (H00001414-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta B1 Crystallin Antibody (H00001414-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta B1 Crystallin Products

Bioinformatics Tool for beta B1 Crystallin Antibody (H00001414-M01)

Discover related pathways, diseases and genes to beta B1 Crystallin Antibody (H00001414-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta B1 Crystallin Antibody (H00001414-M01)

Discover more about diseases related to beta B1 Crystallin Antibody (H00001414-M01).
 

Pathways for beta B1 Crystallin Antibody (H00001414-M01)

View related products by pathway.

PTMs for beta B1 Crystallin Antibody (H00001414-M01)

Learn more about PTMs related to beta B1 Crystallin Antibody (H00001414-M01).
 

Research Areas for beta B1 Crystallin Antibody (H00001414-M01)

Find related products by research area.

Blogs on beta B1 Crystallin

There are no specific blogs for beta B1 Crystallin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta B1 Crystallin Antibody (2B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYBB1
Entrez
OMIM
Uniprot