Recombinant Human beta-Arrestin 1 Protein

Images

 
SDS-Page: Recombinant Human beta-Arrestin 1 Protein [H00000408-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human beta-Arrestin 1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 13 - 122 of Human ARRB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARRB1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human beta-Arrestin 1 Protein

  • ARB1
  • ARR1
  • ARRB1
  • arrestin 2
  • Arrestin beta-1
  • arrestin, beta 1
  • betaArrestin 1
  • beta-Arrestin 1
  • beta-arrestin-1

Background

ARRB1 - arrestin, beta 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24569
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, Simple Western, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-90008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00000408-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01) (0)

There are no publications for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01) (0)

There are no reviews for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional beta-Arrestin 1 Products

Bioinformatics Tool for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01)

Discover related pathways, diseases and genes to beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01)

Discover more about diseases related to beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01).
 

Pathways for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01)

View related products by pathway.

PTMs for beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01)

Learn more about PTMs related to beta-Arrestin 1 Partial Recombinant Protein (H00000408-Q01).

Blogs on beta-Arrestin 1

There are no specific blogs for beta-Arrestin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human beta-Arrestin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARRB1
Entrez