Beta 2 Adaptin Antibody (2D5)

Images

 
Immunohistochemistry-Paraffin: Beta 2 Adaptin Antibody (2D5) [H00000163-M01] - Analysis of monoclonal antibody to AP2B1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Sandwich ELISA: Beta 2 Adaptin Antibody (2D5) [H00000163-M01] - Detection limit for recombinant GST tagged AP2B1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Beta 2 Adaptin Antibody (2D5) Summary

Immunogen
AP2B1 (NP_001273.1 585 a.a. - 651 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Specificity
Reacts with adaptor-related protein complex 2, beta 1 subunit.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AP2B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Beta 2 Adaptin Antibody (2D5)

  • Adapter-related protein complex 2 beta subunit
  • Adaptor protein complex AP-2 subunit beta
  • adaptor-related protein complex 2, beta 1 subunit
  • ADTB2adaptin, beta 2 (beta)
  • AP105B
  • AP2-BETA
  • beta-2-adaptin
  • beta-adaptin
  • CLAPB1AP-2 complex subunit beta
  • Clathrin assembly protein complex 2 beta large chain
  • clathrin-associated/assembly/adaptor protein, large, beta 1
  • DKFZp781K0743
  • Plasma membrane adaptor HA2/AP2 adaptin beta subunit

Background

The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-00834
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00000163-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Beta 2 Adaptin Antibody (H00000163-M01) (0)

There are no publications for Beta 2 Adaptin Antibody (H00000163-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta 2 Adaptin Antibody (H00000163-M01) (0)

There are no reviews for Beta 2 Adaptin Antibody (H00000163-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Beta 2 Adaptin Antibody (H00000163-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Beta 2 Adaptin Products

Bioinformatics Tool for Beta 2 Adaptin Antibody (H00000163-M01)

Discover related pathways, diseases and genes to Beta 2 Adaptin Antibody (H00000163-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beta 2 Adaptin Antibody (H00000163-M01)

Discover more about diseases related to Beta 2 Adaptin Antibody (H00000163-M01).
 

Pathways for Beta 2 Adaptin Antibody (H00000163-M01)

View related products by pathway.

Blogs on Beta 2 Adaptin

There are no specific blogs for Beta 2 Adaptin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Beta 2 Adaptin Antibody (2D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2B1
Entrez
Uniprot