Recombinant Human BET1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BET1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-95 of Human BET1

Source: Wheat Germ

Amino Acid Sequence: MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
BET1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BET1 Protein

  • Bet1 (S. cerevisiae) homolog
  • BET1 homolog (S. cerevisiae)
  • BET1 homolog
  • Bet1p homolog
  • blocked early in transport 1 homolog (S. cerevisiae)
  • DKFZp781C0425
  • Golgi vesicular membrane trafficking protein p18
  • Golgi vesicular membrane-trafficking protein p18
  • hbet1

Background

BET1 - BET1 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-58069
Species: Hu
Applications: ICC/IF
H00026984-P01
Species: Hu
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02031
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91277
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-93714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BET1 Partial Recombinant Protein (H00010282-Q01) (0)

There are no publications for BET1 Partial Recombinant Protein (H00010282-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BET1 Partial Recombinant Protein (H00010282-Q01) (0)

There are no reviews for BET1 Partial Recombinant Protein (H00010282-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BET1 Partial Recombinant Protein (H00010282-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BET1 Products

BET1 H00010282-Q01

Bioinformatics Tool for BET1 Partial Recombinant Protein (H00010282-Q01)

Discover related pathways, diseases and genes to BET1 Partial Recombinant Protein (H00010282-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BET1 Partial Recombinant Protein (H00010282-Q01)

Discover more about diseases related to BET1 Partial Recombinant Protein (H00010282-Q01).
 

Pathways for BET1 Partial Recombinant Protein (H00010282-Q01)

View related products by pathway.

PTMs for BET1 Partial Recombinant Protein (H00010282-Q01)

Learn more about PTMs related to BET1 Partial Recombinant Protein (H00010282-Q01).

Blogs on BET1

There are no specific blogs for BET1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SNAP25 Antibody
NBP1-88769

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BET1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BET1