Bend6 Antibody


Immunohistochemistry-Paraffin: Bend6 Antibody [NBP1-88811] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry: Bend6 Antibody [NBP1-88811] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Bend6 Antibody [NBP1-88811] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Bend6 Antibody [NBP1-88811] - Staining in human cerebral cortex and duodenum tissues using anti-BEND6 antibody. Corresponding BEND6 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Bend6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KLTNTRKENSRLRQSLVMLQVLPQAVTQFEELVGMAEALLKGGGTMSTSASTLWRATNNSSPDSFASTCS
Specificity of human Bend6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Bend6 Protein (NBP1-88811PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Bend6 Antibody

  • BEN domain-containing protein 6
  • bA203B9.1
  • BEN domain containing 6
  • C6orf65


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Bend6 Antibody (NBP1-88811) (0)

There are no publications for Bend6 Antibody (NBP1-88811).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bend6 Antibody (NBP1-88811) (0)

There are no reviews for Bend6 Antibody (NBP1-88811). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Bend6 Antibody (NBP1-88811) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Bend6 Products

Bend6 NBP1-88811

Bioinformatics Tool for Bend6 Antibody (NBP1-88811)

Discover related pathways, diseases and genes to Bend6 Antibody (NBP1-88811). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Bend6

There are no specific blogs for Bend6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Bend6 Antibody and receive a gift card or discount.


Gene Symbol BEND6