KIAA1586 Antibody

Images

 
Western Blot: KIAA1586 Antibody [NBP1-86291] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: KIAA1586 Antibody [NBP1-86291] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane.
Immunohistochemistry-Paraffin: KIAA1586 Antibody [NBP1-86291] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: KIAA1586 Antibody [NBP1-86291] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: KIAA1586 Antibody [NBP1-86291] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: KIAA1586 Antibody [NBP1-86291] - Staining in human testis and skeletal muscle tissues using anti-KIAA1586 antibody. Corresponding KIAA1586 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA1586 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NKTTRQASLRKKIREHDVSKAHGKIQDLLKESTNDSICNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGARELQEKNGEVNCLNTRYSATRI
Specificity
Specificity of human KIAA1586 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1586
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIAA1586 Protein (NBP1-86291PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1586 Antibody

  • FLJ30162
  • hypothetical protein LOC57691
  • KIAA1586

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80330
Species: Hu
Applications: WB
NB100-56087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86366
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KIAA1586 Antibody (NBP1-86291) (0)

There are no publications for KIAA1586 Antibody (NBP1-86291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1586 Antibody (NBP1-86291) (0)

There are no reviews for KIAA1586 Antibody (NBP1-86291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIAA1586 Antibody (NBP1-86291) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KIAA1586 Antibody (NBP1-86291)

Discover related pathways, diseases and genes to KIAA1586 Antibody (NBP1-86291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1586 Antibody (NBP1-86291)

Discover more about diseases related to KIAA1586 Antibody (NBP1-86291).

Blogs on KIAA1586

There are no specific blogs for KIAA1586, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1586 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1586