BAP29 Antibody

Images

 
Western Blot: BAP29 Antibody [NBP1-69711] - This Anti-BCAP29 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAP29 Antibody Summary

Immunogen
Synthetic peptides corresponding to BCAP29(B-cell receptor-associated protein 29) The peptide sequence was selected from the middle region of BCAP29. Peptide sequence GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCAP29
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BCAP29 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BAP29 Antibody

  • Bap29
  • BAP29DKFZp686M2086
  • B-cell receptor-associated protein 29
  • BCR-associated protein 29
  • FLJ53907

Background

BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97439
Species: Hu, Bv, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28140
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB4500
Species: Hu
Applications: CyTOF-ready, ICFlow
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00026959-T01
Species: Hu
AF6278
Species: Hu, Mu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-33773
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91854
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for BAP29 Antibody (NBP1-69711) (0)

There are no publications for BAP29 Antibody (NBP1-69711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAP29 Antibody (NBP1-69711) (0)

There are no reviews for BAP29 Antibody (NBP1-69711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAP29 Antibody (NBP1-69711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAP29 Products

Bioinformatics Tool for BAP29 Antibody (NBP1-69711)

Discover related pathways, diseases and genes to BAP29 Antibody (NBP1-69711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAP29 Antibody (NBP1-69711)

Discover more about diseases related to BAP29 Antibody (NBP1-69711).
 

Pathways for BAP29 Antibody (NBP1-69711)

View related products by pathway.

Research Areas for BAP29 Antibody (NBP1-69711)

Find related products by research area.

Blogs on BAP29

There are no specific blogs for BAP29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAP29 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAP29