B3GAT2 Antibody

Images

 
Immunohistochemistry-Paraffin: B3GAT2 Antibody [NBP1-81828] - Staining of human corpus, uterine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GAT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWHTRTEKVNLANEPKYHLDTVK
Specificity
Specificity of human B3GAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B3GAT2 Antibody

  • beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)
  • Beta-1,3-glucuronyltransferase 2
  • EC 2.4.1.135
  • GlcAT-D
  • GlcAT-S
  • GLCATSgalactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2
  • Glucuronosyltransferase S
  • KIAA1963glcAT-D
  • MGC138535
  • UDP-glucuronosyltransferase S
  • UDP-glucuronyltransferase S
  • uridine diphosphate glucuronic acid:acceptor glucuronosyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
MAB1799
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-24476
Species: Hu, Pm
Applications: WB, IHC-P
AF4429
Species: Mu
Applications: WB, IHC
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-57960
Species: Hu
Applications: ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for B3GAT2 Antibody (NBP1-81828) (0)

There are no publications for B3GAT2 Antibody (NBP1-81828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GAT2 Antibody (NBP1-81828) (0)

There are no reviews for B3GAT2 Antibody (NBP1-81828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for B3GAT2 Antibody (NBP1-81828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GAT2 Products

Bioinformatics Tool for B3GAT2 Antibody (NBP1-81828)

Discover related pathways, diseases and genes to B3GAT2 Antibody (NBP1-81828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GAT2 Antibody (NBP1-81828)

Discover more about diseases related to B3GAT2 Antibody (NBP1-81828).
 

Pathways for B3GAT2 Antibody (NBP1-81828)

View related products by pathway.

PTMs for B3GAT2 Antibody (NBP1-81828)

Learn more about PTMs related to B3GAT2 Antibody (NBP1-81828).

Blogs on B3GAT2

There are no specific blogs for B3GAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GAT2