B3GALT2 Antibody

Images

 
Western Blot: B3GALT2 Antibody [NBP1-69014] - Mouse Brain lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: B3GALT2 Antibody [NBP1-69014] - SampleType : Adult mouse cortex Dilution : 1: 500 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1: 1000 Color/Signal Descriptions : Red: B3Galt2 ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GALT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to B3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2) The peptide sequence was selected from the C terminal of B3galt2. Peptide sequence RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GALT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against B3galt2 and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GALT2 Antibody

  • beta-1,3-galactosyltransferase 2
  • Beta-1,3-GalTase 2
  • Beta3GalT2
  • beta-3-galt2
  • beta3Gal-T2
  • EC 2.4.1
  • EC 2.4.1.-
  • GLCT2
  • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
  • UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2

Background

B3galt2 is beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. B3galt2 can also utilize substrates with a terminal galactose residue, albeit with lower efficiency. B3galt2 is involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69327
Species: Hu
Applications: WB
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NB200-184
Species: Hu, Mu
Applications: WB, IP
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30879
Species: Hu
Applications: IHC, IHC-P
NBP1-69014
Species: Mu
Applications: WB, IHC

Publications for B3GALT2 Antibody (NBP1-69014) (0)

There are no publications for B3GALT2 Antibody (NBP1-69014).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALT2 Antibody (NBP1-69014) (0)

There are no reviews for B3GALT2 Antibody (NBP1-69014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALT2 Antibody (NBP1-69014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALT2 Products

Bioinformatics Tool for B3GALT2 Antibody (NBP1-69014)

Discover related pathways, diseases and genes to B3GALT2 Antibody (NBP1-69014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GALT2 Antibody (NBP1-69014)

Discover more about diseases related to B3GALT2 Antibody (NBP1-69014).

Blogs on B3GALT2

There are no specific blogs for B3GALT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALT2
Uniprot