ASB17 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 78-177 of mouse ASB17 (NP_080034.2). GHRFELNFNLEFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCSLALIWRTFTPVYCPSPLSGITPLLYVAQTRQSNILKILLQYGILEREKN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ASB17 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ASB17 Antibody - Azide and BSA Free
Background
ASB17 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3ubiquitin-protein ligase complex which mediates the ubiquitination and subsequentproteasomal degradation of targetproteins
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for ASB17 Antibody (NBP3-15987) (0)
There are no publications for ASB17 Antibody (NBP3-15987).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ASB17 Antibody (NBP3-15987) (0)
There are no reviews for ASB17 Antibody (NBP3-15987).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ASB17 Antibody (NBP3-15987) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ASB17 Products
Research Areas for ASB17 Antibody (NBP3-15987)
Find related products by research area.
|
Blogs on ASB17