ASB17 Antibody - Azide and BSA Free

Western Blot: ASB17 Antibody [NBP3-15987] - Western blot analysis of extracts of LNCaP cells, using ASB17 antibody (NBP3-15987) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Western Blot: ASB17 Antibody [NBP3-15987] - Western blot analysis of extracts of Rat testis, using ASB17 antibody (NBP3-15987) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ASB17 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 78-177 of mouse ASB17 (NP_080034.2). GHRFELNFNLEFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCSLALIWRTFTPVYCPSPLSGITPLLYVAQTRQSNILKILLQYGILEREKN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASB17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 50% glycerol, pH7.3
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ASB17 Antibody - Azide and BSA Free

• ankyrin repeat and SOCS box containing 17
• ankyrin repeat and SOCS box protein 17
• ankyrin repeat and SOCS box-containing 17
• Asb-17

Background

ASB17 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3ubiquitin-protein ligase complex which mediates the ubiquitination and subsequentproteasomal degradation of targetproteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASB17