ASB11 Antibody

Product Discontinued

ASB11 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ASB11(ankyrin repeat and SOCS box-containing 11) The peptide sequence was selected from the C terminal of ASB11. Peptide sequence GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV.
• Predicted Species: Equine (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASB11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ASB11 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASB11 Antibody

• ankyrin repeat and SOCS box containing 11
• ankyrin repeat and SOCS box protein 11
• ankyrin repeat and SOCS box-containing 11
• ankyrin repeat domain-containing SOCS box protein ASB11
• ASB-11
• DKFZp779E2460
• MGC119168
• MGC119169

Background

ASB11 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASB11
• Uniprot:
  • Q8WXH4(Human)