Recombinant Human ARL13B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARL13B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 329 - 428 of Human ARL13B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS

Protein/Peptide Type
Partial Recombinant Protein
Gene
ARL13B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARL13B Protein

  • ADP-ribosylation factor-like 13B
  • ADP-ribosylation factor-like 2-like 1
  • ADP-ribosylation factor-like protein 13B
  • ADP-ribosylation factor-like protein 2-like 1
  • ARL2L1MGC120611
  • ARL2-like protein 1
  • DKFZp686E2075
  • DKFZp686L2472
  • DKFZp761H079
  • JBTS8DKFZp686M2074
  • MGC120612

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
H00004867-D01P
Species: Hu, Mu
Applications: WB
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49463
Species: Hu
Applications: IHC, IHC-P
NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-92683
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for ARL13B Partial Recombinant Protein (H00200894-Q01) (0)

There are no publications for ARL13B Partial Recombinant Protein (H00200894-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL13B Partial Recombinant Protein (H00200894-Q01) (0)

There are no reviews for ARL13B Partial Recombinant Protein (H00200894-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL13B Partial Recombinant Protein (H00200894-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARL13B Products

Bioinformatics Tool for ARL13B Partial Recombinant Protein (H00200894-Q01)

Discover related pathways, diseases and genes to ARL13B Partial Recombinant Protein (H00200894-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL13B Partial Recombinant Protein (H00200894-Q01)

Discover more about diseases related to ARL13B Partial Recombinant Protein (H00200894-Q01).
 

Pathways for ARL13B Partial Recombinant Protein (H00200894-Q01)

View related products by pathway.

PTMs for ARL13B Partial Recombinant Protein (H00200894-Q01)

Learn more about PTMs related to ARL13B Partial Recombinant Protein (H00200894-Q01).

Blogs on ARL13B

There are no specific blogs for ARL13B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ARL13B Antibody
NBP2-15463
GLI-1 Antibody
NB600-600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARL13B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL13B