Recombinant Human ARFGAP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARFGAP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-516 of Human ARFGAP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSRYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKKFGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLPNAPDMAQFKQGVRSVAGKLSVFANGVVTSIQDRYGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ARFGAP3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARFGAP3 Protein

  • ADP-ribosylation factor GTPase activating protein 1
  • ADP-ribosylation factor GTPase activating protein 3
  • ADP-ribosylation factor GTPase-activating protein 3
  • ARF GAP 3
  • ARFGAP1
  • FLJ45618

Background

The protein encoded by this gene is a GTPase-activating protein (GAP) which associates with the Golgi apparatus and which is thought to interact with ADP-ribosylation factor 1 (ARF1). The encoded protein likely promotes hydrolysis of ARF1-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-83687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84534
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009815-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31261
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for ARFGAP3 Recombinant Protein (H00026286-P01) (0)

There are no publications for ARFGAP3 Recombinant Protein (H00026286-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARFGAP3 Recombinant Protein (H00026286-P01) (0)

There are no reviews for ARFGAP3 Recombinant Protein (H00026286-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARFGAP3 Recombinant Protein (H00026286-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARFGAP3 Products

Bioinformatics Tool for ARFGAP3 Recombinant Protein (H00026286-P01)

Discover related pathways, diseases and genes to ARFGAP3 Recombinant Protein (H00026286-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFGAP3 Recombinant Protein (H00026286-P01)

Discover more about diseases related to ARFGAP3 Recombinant Protein (H00026286-P01).
 

Pathways for ARFGAP3 Recombinant Protein (H00026286-P01)

View related products by pathway.

PTMs for ARFGAP3 Recombinant Protein (H00026286-P01)

Learn more about PTMs related to ARFGAP3 Recombinant Protein (H00026286-P01).

Blogs on ARFGAP3

There are no specific blogs for ARFGAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARFGAP3 Antibody
NBP1-88842
LRRK2 Antibody
NB300-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARFGAP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARFGAP3