AP4E1 Antibody - BSA Free

Western Blot: AP4E1 Antibody [NBP2-84440] - Host: Rabbit. Target Name: AP4E1. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AP4E1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AP4E1. Peptide sequence: CSSFSSLSNVAYEDDYYSNTLHDTGDKELKKFSLTSELLDSESLTELPLV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP4E1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AP4E1 Antibody - BSA Free

• Adapter-related protein complex 4 subunit epsilon-1
• adaptor-related protein complex 4, epsilon 1 subunit
• adaptor-related protein complex AP-4 epsilon
• AP-4 adapter complex subunit epsilon
• AP-4 complex subunit epsilon-1
• AP-4-EPSILON
• DKFZp686L12167
• Epsilon subunit of AP-4
• epsilon-adaptin

Background

AP4E1, also known as AP-4 complex subunit epsilon-1, contains a 127 kDa and a 119 kDa isoform, and is a part of a clathrin- or nonclathrin-coated vesicle, which pursues proteins from the trans-Golgi network as they move towards the endosomal-lysosomal system. Current research is being conducted to determine the relation between AP4E1 and several diseases and disorders, such as paraplegia, neuronitis, intellectual disability, spasticity, malaria, short stature, and cerebriitis. The protein is linked to intracellular protein transport and Golgi associated vesicle biogenesis, through which it interacts with AP4B1, ARF1, AP4M1, AP4S1, and ALB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP4E1