Recombinant Human AP2S1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AP2S1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-142 of Human AP2S1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Protein/Peptide Type
Recombinant Protein
Gene
AP2S1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AP2S1 Protein

  • Adapter-related protein complex 2 sigma subunit
  • Adaptor protein complex AP-2 subunit sigma
  • adaptor-related protein complex 2, sigma 1 subunit
  • AP17HA2 17 kDa subunit
  • AP-2 complex subunit sigma
  • CLAPS2AP17-DELTA
  • Clathrin assembly protein 2 small chain
  • Clathrin coat assembly protein AP17
  • Clathrin coat-associated protein AP17
  • clathrin-associated/assembly/adaptor protein, small 2 (17kD)
  • Plasma membrane adaptor AP-2 17 kDa protein
  • sigma2-adaptin

Background

AP2S1( AAH06337, 1 a.a. - 143 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49265
Species: Hu
Applications: IHC, IHC-P
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-00834
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBL1-09387
Species: Hu
NBP2-46738
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91674
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15563
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001175-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for AP2S1 Recombinant Protein (H00001175-P01) (0)

There are no publications for AP2S1 Recombinant Protein (H00001175-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2S1 Recombinant Protein (H00001175-P01) (0)

There are no reviews for AP2S1 Recombinant Protein (H00001175-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP2S1 Recombinant Protein (H00001175-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP2S1 Products

Bioinformatics Tool for AP2S1 Recombinant Protein (H00001175-P01)

Discover related pathways, diseases and genes to AP2S1 Recombinant Protein (H00001175-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP2S1 Recombinant Protein (H00001175-P01)

Discover more about diseases related to AP2S1 Recombinant Protein (H00001175-P01).
 

Pathways for AP2S1 Recombinant Protein (H00001175-P01)

View related products by pathway.

Blogs on AP2S1

There are no specific blogs for AP2S1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TGN46 Antibody
NBP1-49643
AP2S1 Antibody (3E4.)
H00001175-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AP2S1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2S1