AP1G2 Antibody - BSA Free

Western Blot: AP1G2 Antibody [NBP2-82632] - Host: Rabbit. Target Name: AP1G2. Sample Tissue: Mouse Heart lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AP1G2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse AP1G2. Peptide sequence: TLVTTGYSTEHSISGVSDPFLQVQILRLLRILGRNHEESSETMNDLLAQV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP1G2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AP1G2 Antibody - BSA Free

• adaptor-related protein complex 1, gamma 2 subunit
• AP-1 complex subunit gamma-like 2
• clathrin-associated/assembly/adaptor protein, large, gamma-2
• G2AD
• gamma2-adaptin

Background

AP1G2, also known as AP-1 complex subunit gamma-like 2, consists of a 785 amino acid isoform that is 87 kDa, and is involved in protein sorting and transferring molecules between the trans-Golgi network and the surface of the cell. Disease research is currently being conducted on the relation between AP1G2 and malaria, sarcoma, hepatitis, immunodeficiency, and Kaposi's sarcoma. The protein interacts with RABEP1, XRN1, AP1S1, SYNRG, and NEDD4 in the Transport Clathrin-coated vesicle cycle and Clathrin-dependent protein traffic.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP1G2