ANO6 Antibody


Western Blot: ANO6 Antibody [NBP1-74204] - Mouse Liver Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

ANO6 Antibody Summary

Synthetic peptides corresponding to the middle region of Ano6. Immunizing peptide sequence SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Ano6 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANO6 Antibody

  • anoctamin 6
  • anoctamin-6
  • MGC104751
  • Transmembrane protein 16FTMEM16FDKFZp313M0720


Ano6 may act as a calcium-activated chloride channel By similarity. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB

Publications for ANO6 Antibody (NBP1-74204) (0)

There are no publications for ANO6 Antibody (NBP1-74204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANO6 Antibody (NBP1-74204) (0)

There are no reviews for ANO6 Antibody (NBP1-74204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANO6 Antibody (NBP1-74204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP1-74204

Bioinformatics Tool for ANO6 Antibody (NBP1-74204)

Discover related pathways, diseases and genes to ANO6 Antibody (NBP1-74204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANO6 Antibody (NBP1-74204)

Discover more about diseases related to ANO6 Antibody (NBP1-74204).

Pathways for ANO6 Antibody (NBP1-74204)

View related products by pathway.

Blogs on ANO6

There are no specific blogs for ANO6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANO6 Antibody and receive a gift card or discount.


Gene Symbol ANO6