ANKRD28 Antibody - BSA Free

Western Blot: ANKRD28 Antibody [NBP2-83933] - Host: Rabbit. Target Name: ANKRD28. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

ANKRD28 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD28. Peptide sequence: IVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD28
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ANKRD28 Antibody - BSA Free

• ankyrin repeat domain 28
• Ankyrin repeat domain-containing protein 28
• KIAA0379PITKPP6-ARS-Aphosphatase interactor targeting K protein
• Phosphatase interactor targeting protein hnRNP K
• protein phosphatase 6 ankyrin repeat subunit A
• serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
• Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A

Background

PITK was previously identified as a novel PP1 targeting subunit implicated in modulating the phosphorylation of the transcriptional regulator heterogeneous nuclear ribonucleoprotein K (hnRNP K). Through the phosphorylation of PITK at S1013 and S1017 (residues that flank or reside within a PP1C-binding motif), the binding of the PP1 catalytic subunit to PITK, and subsequently the activity of the holoenzyme, are discretely controlled.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD28