Amiloride-sensitive cation channel 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Amiloride-sensitive cation channel 3 Antibody [NBP2-62624] - Immunohistochemistry analysis in human cerebral cortex and cervix, uterine tissues using Anti-ASIC3 antibody. Corresponding ASIC3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Amiloride-sensitive cation channel 3 Antibody [NBP2-62624] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Amiloride-sensitive cation channel 3 Antibody [NBP2-62624] - Staining of human cervix, uterine shows low expression as expected.

Product Discontinued

Amiloride-sensitive cation channel 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRM
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASIC3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Amiloride-sensitive cation channel 3 Antibody - BSA Free

• ACCN3
• Acid-sensing ion channel 3
• Amiloride-sensitive cation channel 3
• amiloride-sensitive cation channel 3, testis
• ASIC3
• ASIC3hTNaC1
• DRASIC
• hASIC3
• modulatory subunit of ASIC2a
• Neuronal amiloride-sensitive cation channel 3
• proton-gated cation channel subunit
• SLNAC1
• Testis sodium channel 1
• TNAC1

Background

The Amiloride-sensitive cation channel 3 gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASIC3