Amiloride-sensitive cation channel 3 Antibody


Immunocytochemistry/ Immunofluorescence: Amiloride-sensitive cation channel 3 Antibody [NBP2-14322] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Amiloride-sensitive cation channel 3 Antibody [NBP2-14322] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Amiloride-sensitive cation channel 3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FRDKVLGYFWNRQHSQRHSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCA VTKTLSASHRTCYLVTQL
Specificity of human Amiloride-sensitive cation channel 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Amiloride-sensitive cation channel 3 Protein (NBP2-14322PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Amiloride-sensitive cation channel 3 Antibody

  • Acid-sensing ion channel 3
  • amiloride-sensitive cation channel 3
  • amiloride-sensitive cation channel 3, testis
  • ASIC3hTNaC1
  • hASIC3
  • modulatory subunit of ASIC2a
  • Neuronal amiloride-sensitive cation channel 3
  • proton-gated cation channel subunit
  • SLNAC1
  • Testis sodium channel 1
  • TNaC1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Ca
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC

Publications for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322) (0)

There are no publications for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322) (0)

There are no reviews for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Amiloride-sensitive cation channel 3 Products

Bioinformatics Tool for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Discover related pathways, diseases and genes to Amiloride-sensitive cation channel 3 Antibody (NBP2-14322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Discover more about diseases related to Amiloride-sensitive cation channel 3 Antibody (NBP2-14322).

Pathways for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

View related products by pathway.

PTMs for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Learn more about PTMs related to Amiloride-sensitive cation channel 3 Antibody (NBP2-14322).

Research Areas for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Find related products by research area.

Blogs on Amiloride-sensitive cation channel 3

There are no specific blogs for Amiloride-sensitive cation channel 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Amiloride-sensitive cation channel 3 Antibody and receive a gift card or discount.


Gene Symbol ASIC3