Amiloride-sensitive cation channel 3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Amiloride-sensitive cation channel 3 Antibody [NBP2-14322] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Amiloride-sensitive cation channel 3 Antibody [NBP2-14322] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Amiloride-sensitive cation channel 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRDKVLGYFWNRQHSQRHSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCA VTKTLSASHRTCYLVTQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASIC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Amiloride-sensitive cation channel 3 Protein (NBP2-14322PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Amiloride-sensitive cation channel 3 Antibody

  • Acid-sensing ion channel 3
  • amiloride-sensitive cation channel 3
  • amiloride-sensitive cation channel 3, testis
  • ASIC3hTNaC1
  • DRASIC
  • hASIC3
  • modulatory subunit of ASIC2a
  • Neuronal amiloride-sensitive cation channel 3
  • proton-gated cation channel subunit
  • SLNAC1
  • Testis sodium channel 1
  • TNaC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22409
Species: Mu
Applications: WB, ICC/IF, IHC
NB300-188
Species: Rt
Applications: IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-15241
Species: Hu
Applications: WB
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322) (0)

There are no publications for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322) (0)

There are no reviews for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Amiloride-sensitive cation channel 3 Products

Bioinformatics Tool for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Discover related pathways, diseases and genes to Amiloride-sensitive cation channel 3 Antibody (NBP2-14322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Discover more about diseases related to Amiloride-sensitive cation channel 3 Antibody (NBP2-14322).
 

Pathways for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

View related products by pathway.

PTMs for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Learn more about PTMs related to Amiloride-sensitive cation channel 3 Antibody (NBP2-14322).
 

Research Areas for Amiloride-sensitive cation channel 3 Antibody (NBP2-14322)

Find related products by research area.

Blogs on Amiloride-sensitive cation channel 3

There are no specific blogs for Amiloride-sensitive cation channel 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amiloride-sensitive cation channel 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASIC3
Entrez
Uniprot