Ameloblastin Antibody

Images

 
Western Blot: Ameloblastin Antibody [NBP2-88765] - WB Suggested Anti-AMBN Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell
Western Blot: Ameloblastin Antibody [NBP2-88765] - Host: Rabbit. Target: AMBN. Positive control (+): 293T Cell Lysate (2T). Negative control (-): A549 Cell Lysate (N03). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ameloblastin Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Ameloblastin. Peptide sequence: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
AMBN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ameloblastin Antibody

  • AMBN
  • Ameloblastin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87446
Species: Hu, Rt
Applications: WB, IHC, IHC-P
MAB1142
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-62322
Species: Hu
Applications: WB
H00000265-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46517
Species: Hu
Applications: WB, IHC
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
H00054959-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-92428
Species: Hu
Applications: WB, ICC/IF
NBL1-14964
Species: Hu
NBP2-88765
Species: Hu
Applications: WB

Publications for Ameloblastin Antibody (NBP2-88765) (0)

There are no publications for Ameloblastin Antibody (NBP2-88765).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ameloblastin Antibody (NBP2-88765) (0)

There are no reviews for Ameloblastin Antibody (NBP2-88765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ameloblastin Antibody (NBP2-88765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ameloblastin Products

Bioinformatics Tool for Ameloblastin Antibody (NBP2-88765)

Discover related pathways, diseases and genes to Ameloblastin Antibody (NBP2-88765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ameloblastin Antibody (NBP2-88765)

Discover more about diseases related to Ameloblastin Antibody (NBP2-88765).
 

Pathways for Ameloblastin Antibody (NBP2-88765)

View related products by pathway.

PTMs for Ameloblastin Antibody (NBP2-88765)

Learn more about PTMs related to Ameloblastin Antibody (NBP2-88765).

Blogs on Ameloblastin

There are no specific blogs for Ameloblastin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ameloblastin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMBN