AMDHD1 Antibody


Western Blot: AMDHD1 Antibody [NBP1-82701] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: AMDHD1 Antibody [NBP1-82701] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & actin filaments.
Immunohistochemistry-Paraffin: AMDHD1 Antibody [NBP1-82701] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

AMDHD1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AHSVPKGKTATEAADDIINNHLPKLKELGRNGEIHVDNIDVFCEKGVFDLDSTRRILQRGKDIGLQINFHGDELHPM
Specificity of human AMDHD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AMDHD1 Protein (NBP1-82701PEP)

Reactivity Notes

Mouse (84%), Rat (83%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AMDHD1 Antibody

  • amidohydrolase domain containing 1
  • Amidohydrolase domain-containing protein 1
  • EC
  • MGC35366
  • probable imidazolonepropionase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for AMDHD1 Antibody (NBP1-82701) (0)

There are no publications for AMDHD1 Antibody (NBP1-82701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMDHD1 Antibody (NBP1-82701) (0)

There are no reviews for AMDHD1 Antibody (NBP1-82701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMDHD1 Antibody (NBP1-82701) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for AMDHD1 Antibody (NBP1-82701)

Discover related pathways, diseases and genes to AMDHD1 Antibody (NBP1-82701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMDHD1 Antibody (NBP1-82701)

Discover more about diseases related to AMDHD1 Antibody (NBP1-82701).

Blogs on AMDHD1

There are no specific blogs for AMDHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AMDHD1 Antibody and receive a gift card or discount.


Gene Symbol AMDHD1