Aly Antibody

Western Blot: Aly Antibody [NBP1-90179] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Western Blot: Aly Antibody [NBP1-90179] - Analysis in control (vector only transfected HEK293T lysate) and ALYREF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Aly Antibody [NBP1-90179] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: Aly Antibody [NBP1-90179] - Stainin g of human tonsil shows strong nuclear positivity in non-germinal and germinal center cells.

Immunohistochemistry-Paraffin: Aly Antibody [NBP1-90179] - Staining of human testis shows strong nuclear positivity in cells in seminiferus tubules.

Immunohistochemistry-Paraffin: Aly Antibody [NBP1-90179] - Staining of human liver shows moderate nuclear positivity in hepatocytes.

Immunohistochemistry-Paraffin: Aly Antibody [NBP1-90179] - Staining of human placenta shows strong nuclear positivity in trohphoblastic cells.

Product Discontinued

Aly Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMD
• Predicted Species: Mouse (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALYREF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Aly Antibody

• Ally of AML-1 and LEF-1
• ALY/REF
• ALYBEFbZIP enhancing factor
• bZIP-enhancing factor BEF
• REF
• THO complex 4
• THO complex subunit 4
• tho4
• Transcriptional coactivator Aly/REF

Background

Pre-mRNA splicing plays an important role in regulation of gene expression. During the splicing process, specific proteins are recruited to the mRNA and assembled into a complex of mRNA-protein near the exon-exon junction. This complex is termed the mRNA-protein complex (mRNP) or the exon-exon junction complex. The proteins that are found in this complex include: Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK.1-5 Aly (also known as mREF1-I) is the mammalian homologue of the yeast mRNA export factor Yra1p.6-7 It is a 233 amino acid RNAbinding protein that contains a RNA-binding domain and is recruited to the mRNP complexes during the splicing. Excess of recombinant expression of Aly in the cells increases both the rate and efficiency of spliced and unspliced mRNA export (in vivo) from the nucleus to the cytoplasm. In contrast to the Y14 protein, Aly is dissociated from the mRNAs after the export to the cytoplasm.1, 5-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aly Antibody (NBP1-90179)(2)

Publications using NBP1-90179

• Chen W, Pilling D, Gomer RH The mRNA binding protein DDX3 mediates TGF-?1 upregulation of translation and promotes pulmonary fibrosis JCI insight 2023-02-23 [PMID: 36821384] (WB, Human)
• Dominguez-Sanchez MS, Saez C, Japon MA et al. Differential expression of THOC1 and ALY mRNP biogenesis/export factors in human cancers. BMC Cancer 2011-02-17 [PMID: 21329510]

Bioinformatics

• Gene Symbol: ALYREF