Aly Antibody

Images

 
Western Blot: Aly Antibody [NBP1-90179] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: Aly Antibody [NBP1-90179] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: Aly Antibody [NBP1-90179] - Staining of human testis shows strong nuclear positivity in cells in seminiferus tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aly Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALYREF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aly Protein (NBP1-90179PEP)
Publications
Read Publication using NBP1-90179.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aly Antibody

  • Ally of AML-1 and LEF-1
  • ALY/REF
  • ALYBEFbZIP enhancing factor
  • bZIP-enhancing factor BEF
  • REF
  • THO complex 4
  • THO complex subunit 4
  • tho4
  • Transcriptional coactivator Aly/REF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52455
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP2-13381
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16134
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90179
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aly Antibody (NBP1-90179)(1)

Reviews for Aly Antibody (NBP1-90179) (0)

There are no reviews for Aly Antibody (NBP1-90179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aly Antibody (NBP1-90179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aly Products

Bioinformatics Tool for Aly Antibody (NBP1-90179)

Discover related pathways, diseases and genes to Aly Antibody (NBP1-90179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aly Antibody (NBP1-90179)

Discover more about diseases related to Aly Antibody (NBP1-90179).
 

Pathways for Aly Antibody (NBP1-90179)

View related products by pathway.

PTMs for Aly Antibody (NBP1-90179)

Learn more about PTMs related to Aly Antibody (NBP1-90179).

Blogs on Aly

There are no specific blogs for Aly, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aly Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALYREF