Recombinant Human AGPAT3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AGPAT3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 155-259 of Human AGPAT3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFP

Protein/Peptide Type
Partial Recombinant Protein
Gene
AGPAT3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AGPAT3 Protein

  • 1-acylglycerol-3-phosphate O-acyltransferase 31-acyl-sn-glycerol-3-phosphate acyltransferase gamma
  • EC 2.3.1.51
  • gene similar to plant lysophosphatidic acid acyltransferase10lysophosphatidic acid acyltransferase-gamma1
  • LPAAT-gamma
  • LPAAT-GAMMA1
  • Lysophosphatidic acid acyltransferase gamma
  • MGC4604,1-AGP acyltransferase 3,1-AGPAT 3

Background

AGPAT3 - 1-acylglycerol-3-phosphate O-acyltransferase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-76907
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-30948
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP2-04299
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001040-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-01664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7105
Species: Hu
Applications: WB
NBP1-88921
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for AGPAT3 Partial Recombinant Protein (H00056894-Q01) (0)

There are no publications for AGPAT3 Partial Recombinant Protein (H00056894-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGPAT3 Partial Recombinant Protein (H00056894-Q01) (0)

There are no reviews for AGPAT3 Partial Recombinant Protein (H00056894-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGPAT3 Partial Recombinant Protein (H00056894-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGPAT3 Products

Bioinformatics Tool for AGPAT3 Partial Recombinant Protein (H00056894-Q01)

Discover related pathways, diseases and genes to AGPAT3 Partial Recombinant Protein (H00056894-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT3 Partial Recombinant Protein (H00056894-Q01)

Discover more about diseases related to AGPAT3 Partial Recombinant Protein (H00056894-Q01).
 

Pathways for AGPAT3 Partial Recombinant Protein (H00056894-Q01)

View related products by pathway.

PTMs for AGPAT3 Partial Recombinant Protein (H00056894-Q01)

Learn more about PTMs related to AGPAT3 Partial Recombinant Protein (H00056894-Q01).

Blogs on AGPAT3

There are no specific blogs for AGPAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AGPAT3 Antibody
NBP1-74276
LPCAT2 Antibody
NBP1-88921

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AGPAT3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT3