ADNP2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Adnp2. Peptide sequence: MFQIPVQNLDNIRKVRKRVKGILVDIGLDSCKELLKDLKGFDPGEKYFCN The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADNP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ADNP2 Antibody - BSA Free
Background
ADNP2, or ADNP homeobox protein 2, consists of a 1,131 amino acid isoform that is 123 kDa, and is involved in the regulation of transcription in the nucleus. Current research on ADNP2 includes its involvement in and relation to schizophrenia and neuronitis. This protein interacts with NFYC, CBX1, CBX3, CBX5, and UBC during the processes of transcription, negative regulation of cell death, positive regulation of cell growth, and neuron differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Rt
Applications: WB
Publications for ADNP2 Antibody (NBP2-82582) (0)
There are no publications for ADNP2 Antibody (NBP2-82582).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADNP2 Antibody (NBP2-82582) (0)
There are no reviews for ADNP2 Antibody (NBP2-82582).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADNP2 Antibody (NBP2-82582) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADNP2 Products
Blogs on ADNP2