ADNP2 Antibody - BSA Free

Western Blot: ADNP2 Antibody [NBP2-82582] - WB Suggested Anti-Adnp2 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Testis

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADNP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADNP2 Antibody - BSA Free (NBP2-82582) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Adnp2. Peptide sequence: MFQIPVQNLDNIRKVRKRVKGILVDIGLDSCKELLKDLKGFDPGEKYFCN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADNP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADNP2 Antibody - BSA Free

• ADNP homeobox 2
• ADNP homeobox protein 2
• KIAA0863
• zinc finger protein 508
• ZNF508

Background

ADNP2, or ADNP homeobox protein 2, consists of a 1,131 amino acid isoform that is 123 kDa, and is involved in the regulation of transcription in the nucleus. Current research on ADNP2 includes its involvement in and relation to schizophrenia and neuronitis. This protein interacts with NFYC, CBX1, CBX3, CBX5, and UBC during the processes of transcription, negative regulation of cell death, positive regulation of cell growth, and neuron differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADNP2